PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_65101.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 355aa    MW: 38766.8 Da    PI: 9.3605
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_65101.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1713.7e-5391361128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 
                   lppGfrFhPtdeel+ +yL+++++++++++ ++i++vdiyk++Pw Lp+k++ +++ewyfF++rd+ky++g r+nra+ sgyWkatg+dk++ ++ +
  MLOC_65101.1   9 LPPGFRFHPTDEELILHYLRNRAAQSPCPV-SIIADVDIYKFDPWALPSKASYGDREWYFFTPRDRKYPNGVRPNRAAGSGYWKATGTDKPIRCSaT 104
                   79****************************.89***************988899**************************************99878 PP

           NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                   ge vg+kk Lvfykgr pkg kt+W+mheyrl
  MLOC_65101.1 105 GESVGVKKALVFYKGRPPKGIKTNWIMHEYRL 136
                   999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-635170IPR003441NAC domain
PROSITE profilePS5100561.4759170IPR003441NAC domain
PfamPF023652.5E-2710136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MIMSDPAMLP PGFRFHPTDE ELILHYLRNR AAQSPCPVSI IADVDIYKFD PWALPSKASY  60
GDREWYFFTP RDRKYPNGVR PNRAAGSGYW KATGTDKPIR CSATGESVGV KKALVFYKGR  120
PPKGIKTNWI MHEYRLAAAD AHAANTYRPM KFRNASMRLD DWVLCRIYKK TSQVSPMAVP  180
PLSDHELDEP SGAGAYPMSS AGMTMQGGAG GYTLQAAVPG TQRMPKIPSI SELLNDYSLA  240
QLFDDSGHAL MARHDQHAAL FGHPIMSQFH VNSSGNNMSQ LGQMDSPAST SVARDGAAGK  300
RKRLSEEDGE HNGSTSQPAA AVTNKKPNSS CFGATTFQVG NNTLQGSLGQ PLLHF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-72917217167NO APICAL MERISTEM PROTEIN
1ut4_B3e-72917217167NO APICAL MERISTEM PROTEIN
1ut7_A3e-72917217167NO APICAL MERISTEM PROTEIN
1ut7_B3e-72917217167NO APICAL MERISTEM PROTEIN
3swm_A3e-72917220170NAC domain-containing protein 19
3swm_B3e-72917220170NAC domain-containing protein 19
3swm_C3e-72917220170NAC domain-containing protein 19
3swm_D3e-72917220170NAC domain-containing protein 19
3swp_A3e-72917220170NAC domain-containing protein 19
3swp_B3e-72917220170NAC domain-containing protein 19
3swp_C3e-72917220170NAC domain-containing protein 19
3swp_D3e-72917220170NAC domain-containing protein 19
4dul_A3e-72917217167NAC domain-containing protein 19
4dul_B3e-72917217167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2510580.0AK251058.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf97a05, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557998.10.0PREDICTED: NAC transcription factor NAM-B1-like
TrEMBLM0Y2D50.0M0Y2D5_HORVD; Uncharacterized protein
STRINGMLOC_65101.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.13e-85NAC-like, activated by AP3/PI